PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00822.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 377aa    MW: 42212.2 Da    PI: 5.1076
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00822.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.6e-151461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rgrWT+eEd++l  +++  G g W++ ++  g++R++k+c++rw +yl
  Rsa1.0_00822.1_g00001.1 14 RGRWTAEEDQILSSYIQSNGEGAWRSLPKNAGLKRCGKSCRLRWINYL 61
                             8*********************************************97 PP

2Myb_DNA-binding55.21.7e-1767112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+ T+eE+el v+++  lG++ W++Ia+ ++ gRt++++k++w+++l
  Rsa1.0_00822.1_g00001.1  67 RGNITPEEEELVVKLHSTLGNR-WSLIANQLP-GRTDNEIKNYWNSHL 112
                              7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-21564IPR009057Homeodomain-like
PROSITE profilePS5129416.587961IPR017930Myb domain
SuperFamilySSF466891.05E-2711108IPR009057Homeodomain-like
SMARTSM007173.1E-111363IPR001005SANT/Myb domain
PfamPF002492.5E-131461IPR001005SANT/Myb domain
CDDcd001674.48E-81661No hitNo description
PROSITE profilePS5129426.72262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2665116IPR009057Homeodomain-like
SMARTSM007176.1E-1766114IPR001005SANT/Myb domain
PfamPF002491.7E-1567112IPR001005SANT/Myb domain
CDDcd001671.08E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGRAPCCEKV GIKRGRWTAE EDQILSSYIQ SNGEGAWRSL PKNAGLKRCG KSCRLRWINY  60
LRSDLKRGNI TPEEEELVVK LHSTLGNRWS LIANQLPGRT DNEIKNYWNS HLRRKLHNFI  120
IRKPSISHDV PAVIMKAPPV SPRPPTKRRP GRTSRSAMKP KTHTPKNLKM KKTSESPEPE  180
ANVAVIAVAG EEALMLELNG AEAELGPCNY YGTCHEGGAC RNNNNNNSTD GDKEVSSFDE  240
AIIDLLLDES DPPLVFTSCG GNAQLNHLGN FEQAKGSSEI LNQENLDCLQ SFLSMESFLK  300
YEHQVNNAFT DEFIDWDCVW QQGYDNNICD EKEGSDSMVS WLLDGDDEAT IGKGNCENFG  360
EPLDHDEENA LFAWLLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667440.0KC966744.1 Brassica napus MYB transcription factor 12 (MYB12.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133816.10.0PREDICTED: transcription factor MYB12-like
SwissprotO222641e-178MYB12_ARATH; Transcription factor MYB12
TrEMBLM4C8C50.0M4C8C5_BRARP; Uncharacterized protein
STRINGBra000453.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.11e-168myb domain protein 12